Watching the slapstick 1963 British comedy sketch “Dinner for One”, starring Freddie Frinton and May Warden, is an essential part of the German New Year’s Eve celebration.
Although he cut a fine figure in his youth, “Mad” King Ludwig II of Bavaria started losing his teeth in his twenties – one of the reasons why he became increasingly reclusive in his fairytale castles.
If you ask a German the time and are told “halb drei” (literally “half three”) the time is in fact half past two (half two in English). Germans count the minutes to the next hour rather than after.
The Munich Oktoberfest actually starts in late September. Don’t worry too much if you miss it: there are 60 beer gardens in and around the city that are open all summer.
The Plattdeutsch dialect spoken in parts of northern Germany stems from Old Saxon and contains many words with the same roots as English – “maken” (make), “dat Kniv” (knife), “dat Sailschipp” (sailing ship), “af un an” (sometimes).
Trabant, the name given to East Germany’s answer to Audi and Mercedes Benz, literally means “satellite”. It was intended as a tribute to the first-ever satellite – the Soviet Sputnik, which went into space in 1957.
In 1888 Germany had three emperors: Wilhelm I, Frederick III and Wilhelm II. Frederick III died from cancer of the larynx aged 56 having ruled for just 99 days. A liberal by disposition, he would have been a very different emperor to Wilhelm II.
In 2014 it was 300 years since George I of the Royal House of Hanover ascended to the British throne.
The world’s narrowest street is in Reutlingen. It is called Spreuerhofstrasse and is 31 cm (one foot) wide at its narrowest point.
The word Rindfleischetikettierungsueberwachungsaufgabenuebertragungsgesetz (law delegating beef label monitoring) was removed from the German language this summer, but there are still some crackers – kraftfahrzeughaftpflichtversicherung (automobile liability insurance) and donaudampfschifffahrtsgesellschaftskapitaenswitwe (widow of a Danube steamboat company captain), to name but two.
The American author Mark Twain, not known for being a fan of the German language, once declared: “I never knew before what eternity was made for. It is to give some of us a chance to learn German.”
The term “ecology” was first coined by the German biologist Ernst Haeckel in 1866.
The Chancellor’s office in Berlin is known locally as the “washing machine”.
The following cities have all at one time or another been capitals of Germany: Aachen, Regensburg, Frankfurt-am-Main, Nuremberg, Berlin, Weimar, Bonn (and East Berlin), and, since 1990, Berlin again.
There are over 300 kinds of bread in Germany.
There is a museum in Berlin decidated to the “currywurst”, a popular take on an old favourite involving pieces of pork sausage covered in a spicy ketchup sauce.
We may request cookies to be set on your device. We use cookies to let us know when you visit our websites, how you interact with us, to enrich your user experience, and to customize your relationship with our website.
Click on the different category headings to find out more. You can also change some of your preferences. Note that blocking some types of cookies may impact your experience on our websites and the services we are able to offer.
Essential Website Cookies
These cookies are strictly necessary to provide you with services available through our website and to use some of its features.
Because these cookies are strictly necessary to deliver the website, refusing them will have impact how our site functions. You always can block or delete cookies by changing your browser settings and force blocking all cookies on this website. But this will always prompt you to accept/refuse cookies when revisiting our site.
We fully respect if you want to refuse cookies but to avoid asking you again and again kindly allow us to store a cookie for that. You are free to opt out any time or opt in for other cookies to get a better experience. If you refuse cookies we will remove all set cookies in our domain.
We provide you with a list of stored cookies on your computer in our domain so you can check what we stored. Due to security reasons we are not able to show or modify cookies from other domains. You can check these in your browser security settings.
Google Analytics Cookies
These cookies collect information that is used either in aggregate form to help us understand how our website is being used or how effective our marketing campaigns are, or to help us customize our website and application for you in order to enhance your experience.
If you do not want that we track your visit to our site you can disable tracking in your browser here:
Other external services
We also use different external services like Google Webfonts, Google Maps, and external Video providers. Since these providers may collect personal data like your IP address we allow you to block them here. Please be aware that this might heavily reduce the functionality and appearance of our site. Changes will take effect once you reload the page.
Google Webfont Settings:
Google Map Settings:
Google reCaptcha Settings:
Vimeo and Youtube video embeds:
Other cookies
The following cookies are also needed - You can choose if you want to allow them:
Privacy Policy
You can read about our cookies and privacy settings in detail on our Privacy Policy Page.